FOXO4-DRI

Source high-purity FOXO4-DRI Peptide (CAS 2460055-10-9), a premier senolytic research compound designed for advanced biomedical studies. This cell-permeable peptide antagonist is essential for investigating cellular aging, p53 pathways, and tissue homeostasis. Ideal for laboratories focused on longevity and regenerative medicine. High-quality raw material. Get a quote today!

Product Specification

• Product Name: FOXO4-DRI Peptide (Retro-Inverso)
• Appearance: White to off-white lyophilized powder
• CAS No.: 2460055-10-9
• Molecular Formula: C₂₂₈H₃₈₈N₈₆O₆₄
• Specification: Purity ≥98% (HPLC); Molecular Weight: ~5358.06 Da; Sequence: D-(LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRRRRRQRRKRKG)
• Ingredient Information: Synthetic cell-penetrating peptide; Sterile filtered; Endotoxin <1.0 EU/mg

Product Description

FOXO4-DRI is a specialized retro-inverso peptide engineered to disrupt the interaction between FOXO4 and p53 in senescent cells. As a potent senolytic agent, it selectively induces apoptosis in aged cells while sparing healthy tissues, offering a groundbreaking tool for aging research. Its unique cell-penetrating structure ensures efficient intracellular delivery and enhanced stability compared to native peptides. With the growing focus on longevity and age-related disease mechanisms, FOXO4-DRI stands out for its ability to restore tissue homeostasis and improve organ function in preclinical models. It is a critical reagent for studying cellular senescence, oxidative stress, and metabolic regulation.

Product Uses

FOXO4-DRI is exclusively used in biomedical research and preclinical studies. It is widely applied in senescence models to investigate the clearance of aged cells and the restoration of tissue function. Researchers utilize it to study p53 signaling pathways, insulin resistance, and oxidative stress responses. Additionally, it serves as a key tool in longevity research, helping to evaluate therapeutic strategies for age-related conditions such as sarcopenia, reproductive aging, and metabolic disorders. It is not intended for human consumption or diagnostic use.

Formulation Recommendation

Reconstitution: Dissolve in sterile deionized water or DMSO to create a stock solution (e.g., 1–5 mM). Gentle vortexing is recommended. Aliquot and store at -20°C or -80°C to prevent degradation.
Usage Concentration: Typical working concentrations range from 1–10 μM in cell culture assays, depending on cell type and experimental design.
Compatibility: Compatible with standard cell culture media (DMEM, RPMI). Avoid repeated freeze-thaw cycles. For in vivo studies, ensure proper vehicle selection (e.g., saline with low percentage of solubilizer) to maintain peptide stability and bioavailability.